SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000308357|PACid:22651853 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000308357|PACid:22651853
Domain Number 1 Region: 389-637
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.08e-53
Family Protein kinases, catalytic subunit 0.00064
Further Details:      
 
Domain Number 2 Region: 3-78
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.57e-18
Family alpha-D-mannose-specific plant lectins 0.0061
Further Details:      
 
Weak hits

Sequence:  MDP0000308357|PACid:22651853
Domain Number - Region: 239-308
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00902
Family Anti-platelet protein 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000308357|PACid:22651853
Sequence length 679
Sequence
MSTVWSSNTSRTAQNPVARLLDSGNLVVIDRSDDDSENFLWQSFDYPGDTFLPGMKIGRN
TVTGFNWHLRSWKSPHDPSQGNCTSQLGPKGYAELFVREGSILKFRSGPWNGVWFSGNPQ
LNPNPIYTYSLVSEPDEMYYSYKLHNSSIFSRLMLTSDGLLRRYTWIDRTQGWVLYQTVQ
IDNCDNYALCGVHGACNIQKSPVCSCLKGFTPKFPKEWDLVDWSNGCVRKTSLNCTGDVF
QKYSGLKLPSTEQSWFNRSMNLKECEMVCMKNCSCTAYTNLDIRDGGTGCLLWYGDLIDI
RYIAENGQDIYIRMAAAEQDFLSPKISFVDHEDDTKINSESNAKKMRIIISTTILSTGLL
ILGLALLFYVWKKQHQKGGKXGRNQKEDLELPLFDLMTIVSATSNFSIENKLGEGGFGSV
FKGTMENGQEIAVKRLSKSSRQGLDEFKNEVTHIAKLQHRNLVKLLGCCIQEDEMIXIYE
FMPNKSLDFFIFDQRRRMLLDWPKRFEIINGIARGLLYLHQDSRLRVIHRDLKAKYXIDG
FYSIKSDVYSFGVMVLEIVSGSRNRGFSHPDHKLNLLGHAWMLHTKDMPLKLIDASVEDS
VTLHEVVRTIHVGLLCVQRNPGDRPSMSAVVLMLGGEGALPPPLKPXFYSERDLTELEVS
HSSKACSANEVTISLVEAR
Download sequence
Identical sequences MDP0000308357 MDP0000308357|PACid:22651853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]