SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000308826|PACid:22621027 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000308826|PACid:22621027
Domain Number 1 Region: 301-345
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000305
Family EGF-type module 0.0037
Further Details:      
 
Weak hits

Sequence:  MDP0000308826|PACid:22621027
Domain Number - Region: 268-296
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000109
Family EGF-like domain of nidogen-1 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000308826|PACid:22621027
Sequence length 384
Sequence
MALHWRMHILHLSLVMVVEVTILLATPTPTTAQSLLPPQALPGCPDHCGNLTIPYPFGIG
DGCYLEDRFNITCNISTQQPTTLWMTSDVKITNISLYNGELQILQFAASDCYNAQGNSTR
SNSPELSVPPPCSISKTKNMFVAVGCDTYAFFIGYRGEEEYTTGCMSQCADLGNAIDQRD
TCSGVGCCQTKVPSGLQNGSVTLGSFYNYTDVRDSHRCSYAFLVQESEFNFNSTSFRELN
VTTQLPAIIDWVIGNESCDIAAKNESTFACKANSSCHNRSSGYICQCWSGYEGNPYLPDG
CQDIDECKAPNPCSMGTCINTPGNYTCKCPKGYKNDDPDKIRCIKAXGRAKLSLLLIISL
GXCFCIYXGYWVKGKVELGSCVRT
Download sequence
Identical sequences MDP0000308826|PACid:22621027 MDP0000308826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]