SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000309154|PACid:22621795 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000309154|PACid:22621795
Domain Number 1 Region: 8-141
Classification Level Classification E-value
Superfamily Transferrin receptor-like dimerisation domain 2.88e-26
Family Transferrin receptor-like dimerisation domain 0.0012
Further Details:      
 
Domain Number 2 Region: 283-343
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000000707
Family alpha-D-mannose-specific plant lectins 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000309154|PACid:22621795
Sequence length 435
Sequence
HYKDVLSNLLDGGVSLHPLTTAIQEFAYAAKEAEDEAQKLREXENTSELVVLKKRALNDR
LMLAERGFLDSDGLEGRQWLKHLVYGPPGEHGSKLSFFPGVGDAMLRAKRMSRREGQAKI
QHEXWRVARAIXRAXNSLRGDFKSKKSRPARDCVSFEERIEEITSRISKWMLRRHIYSLI
PIQRTYILMNTIEAAKLGEEDSELRNELNESRDISXKEQMAVILRYVDNKCQVPNMDDLY
VIQGKSLRKAPRKTNRYHHKVELFIDVIDFQLIELDDRFTEVSVLLDTGNLILKDGNETN
PYNYLWQSFDYPCDTLLPEMKLGWXLAIGLERYVSSWKSXEDPASGEFSLWIIFXGLPQL
VSMKGEKIQVRGGSWKGVHVTGXEFSGKRDLNPIXGVEFGLNKDEIYYEYXLQNRSVFSR
YVLGIGERLTLVHQT
Download sequence
Identical sequences MDP0000309154|PACid:22621795 MDP0000309154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]