SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000309290|PACid:22669705 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000309290|PACid:22669705
Domain Number 1 Region: 495-809
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.13e-82
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 77-185
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 9.81e-28
Family alpha-D-mannose-specific plant lectins 0.0042
Further Details:      
 
Weak hits

Sequence:  MDP0000309290|PACid:22669705
Domain Number - Region: 299-326,369-404,483-490
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0659
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000309290|PACid:22669705
Sequence length 827
Sequence
MQSCKALRSFFMCLFFLFSLLRISAATALGTITPSRYIRDGETLVSVGGSYELGFFSLGK
SKSRYLGIWYTVSTDTVVWVANRETPLGDSSGLLKLTEQGVLVLLNSSNSIVWSSNSSRI
AGNPVSQLLDSGNLVVQDGKETNPDNFLWQSFDHPCDTFLPEMKLGWDLVTGLERYLSSW
KSTEDLAPGEFSGRMDLRGLPQLFIMKGSKIHSRGGSWNGLYLTGYGYGPREPNPISGSE
LVMNKDEVYYEYRLRNMSEFSRFVLNPLGVAERFTWVYKTQSWELADKFLADRCESYALC
GLFSSCSINTNSPICACLKGFVPKSLKDWNSGYWSDGCVRRTPLACSDGDGFVKYSGIKL
PDTSTSWFDKSTSLKECKGLCLGNCSCTACANLDIRQGGSGCVLWFGNLIDIKEFTPGGG
QDLYIRVAASELDHVKKKSNFNKRRLPAILLSSAVFLMGLLIVGIRLYIHKKKLRNEGHR
RKDCRDEYLGEDGEEMELPLFDLTTIAKATDNFSSCNKLGEGGFGPVYKGTLIGGKEIAV
KRLSKNSGQGMREFKTEVILIARLQHRNLVKLLGCCIQKDEKILIYEFMPNKSLDFYIFD
QEGQKLLDWPKCFHIISGVARGLLYLHQDSRLRIIHRDLKCSNILLDNNMNPKISDFGLA
KTFGGDQSQANTNRVVGTYGYMSPEYAADGNFSMKSDVFSFGVILLEMLSRKKNRGFRHP
DHDHNLLGHAWILWIQDKPLELIDKTFCDSCNISEVVRCLHVGLLCVQRVPEDRPSMSSV
VLMLSSDVALPPPKQPGFYTERSVHESPTRTLPCSENTFSITMIEAR
Download sequence
Identical sequences MDP0000309290 MDP0000309290|PACid:22669705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]