SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000309624|PACid:22622783 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000309624|PACid:22622783
Domain Number 1 Region: 540-823
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.8e-79
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 143-257
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000000000144
Family alpha-D-mannose-specific plant lectins 0.014
Further Details:      
 
Weak hits

Sequence:  MDP0000309624|PACid:22622783
Domain Number - Region: 246-347
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0368
Family alpha-D-mannose-specific plant lectins 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000309624|PACid:22622783
Sequence length 884
Sequence
MARTRLHVMLFLLASMDGLFMPAALDLCTHHAARRQGHTQTRQPQREKYKFSRSSEXIXV
TLWSLFMATGSXIKYAIILVCFASLWTCHDAIDTLKPGDTLNSTSSLLSASGTFTLNFIE
KVIGGSDNSFIAILRVKSGANKAWIANRDTPILSSSSPLLTLDSNNTLKITHQNGDPFVL
FSXPQTNDPNTSVXATLLDSGNFVLQEVNSVSGSTIRVFWQSFDHPVDTFLPGMKLGIDR
RNGYNWSLLSWGTRDNPVSSGPYSLEWDTDAHQLKIKRSGTVYWTSGVFADGRFEFILPD
VSKKRYNFSIVSNQDEDYLTYASLDDPTDPEPEWVLYTRGALYEYGASVDIIQAQNCDGY
NIVGGCVRRDRCIGEVGDDFQQKKGYFNIVNSSASRPPNWPGTGSEDCKVTCWQNCDCLG
FDFPSGSPTTGAGCRFWSVDCEFLEDFTANTSFVLPATQPHPPDSPPPGKNHATQKWFWI
GISIAAALLVMGFCILGYRLRRTGFMVLAGEKATKIQRRLGRFIKATRPTDQAIILNPDL
HAFTHESVLAATSNFSEANKLGQGGFGTVYKGKLATGQEVAVKRLSKFSGQGTDEFKNEL
ILIYQLQHTNLVQLFGFCIHEEERMLIYEYMPNKSLDYFLFDSTRDRQLDWKERFTIIEG
ITQGMVYLHKYSRKTVIHRDLKAGNILLDQNMNPKISDFGMAKIFTEDLGANTMRIAGTR
GYMPPEYVMGGNFSVKSDVYSYGVLLLEIISGRKNNSLYNEDRALNLVGHAWELWRAGRG
EELRDPTLVETSIRGQLLRCIQVGLLCVEENAAHRPYMSEMISGETXLVLSRIGRLDEYX
AKMSRTEKTTSCQDFDSYRIIRDVFNIYKDLILINLLITSDLXL
Download sequence
Identical sequences MDP0000309624 MDP0000309624|PACid:22622783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]