SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000315366|PACid:22666002 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000315366|PACid:22666002
Domain Number 1 Region: 338-452
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.55e-26
Family Protein kinases, catalytic subunit 0.0022
Further Details:      
 
Domain Number 2 Region: 75-172
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000000000432
Family alpha-D-mannose-specific plant lectins 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000315366|PACid:22666002
Sequence length 471
Sequence
MATCVMMKNSIFLIIFACLWTCHDARDTLAPGDTLDSSSSLESASAKFTLSFVXQRNSNF
KYLAIRRNKYNPNKAWIGNRNRPISSSSSPLLTLDSNYTLKITQTGEDPIVICSAPQTSN
STSSGVVATLLDSGNLELQEMNGSRVFWQSFDYPGDTXLPGMKLGVNHSDGHIWSLVSYV
DTYNPALGPFSLVWDPNEHELKINKSGVVYWTSGVLRSDGTFEFILPNVSKQRYNFSIVS
NENYGYLTYTAVGDQSLQPEWVLYSSGILQEYEGQMNIVQAQNCDGYDTDGGCVRRFQST
KSSGTKIADKWVWIGTSIAAALVLCTAYYLLRRRRSALPSAGHHDLSVFSYSSILAATSN
FAEENKLGEGGFGPVYKGKLAMGQEIAVKRLSKCSGQGTSEFKNELILIYELQHTNLVQL
FGFCIHGXEMMLIYEYLQNKSLDHFLFGEEPRYLISFVKFDICLLXYCQSS
Download sequence
Identical sequences MDP0000315366|PACid:22666002 MDP0000315366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]