SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000317476|PACid:22655503 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MDP0000317476|PACid:22655503
Domain Number - Region: 504-547
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0167
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000317476|PACid:22655503
Sequence length 804
Sequence
MASNSILCCSSHLNPSLFVVVFCLFVHCYSYGEQGPYXSFTVSSFSYPPTTIGPSGFRYI
RVEMPPWFSSIAMNSNVELAAGDIEKVPKVELPLICFRAGSLPLPXVNTSLVNSVSNGIV
XQISPGVWYFGLFNGIGPTRTQSKMINRAPSYSFSANITVEGCTTLTMWGPXCNQTINTL
SCAQSNSYSAADNSSEAGLYNQTIEYVISCKNNFGTCHGDGEPKFYSLDVVGVSHELKIL
AKDVWLNVTSSDNTKNVSDINLMFYARHGALPXETVHDYSSNINKSSLVIQFPKVGRWYX
TVLPLNVSKELEGSLDTDTKVCYSLESKLLECPEGKAGANCTWEMYTLQTSLRKGSSYFE
YYYLLISEKVPPESANFPLDXLLTNSSHGGQPEETWTYFVMDIPRGAAGGHMHIXLNSDD
KVNYEVYARYGGLPSLASWDYFYSNRTSSSHGSMFFNLYNSSEDKVDFYILYIREGTWGF
GLKHLXTTSDASKVPTIMSVSLERCPRRCSSHGKCETALDASGLASYSFCSCDPDHGGFD
CSIELVTPHXVLLLISLMKIGIGHVWQSIFLIASNAAAALPAFWALRQKFMDVWLSFMAV
GSTFVYLGTVEDDLKRALHTAVALLTALMVYTKARRPGNIILVIVIGTIALLIGWLIELS
TKFRSFSFSTRFSLNMLERWVSLERLQAVNGWLKNLIKTTFRRFRWGFILAGLVALAIAA
SSWVLETNESYWIWHSIWHMTIYTSSFFFLCSKESPASTVDTENQIPPXGAYELTRQDSF
SRDRKYYELEKDEKVIEGPWWKLK
Download sequence
Identical sequences MDP0000317476|PACid:22655503 MDP0000317476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]