SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000318256|PACid:22681338 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000318256|PACid:22681338
Domain Number 1 Region: 199-485,656-709
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.25e-47
Family FAD-linked reductases, N-terminal domain 0.000000924
Further Details:      
 
Domain Number 2 Region: 488-657
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 4.81e-31
Family GMC oxidoreductases 0.000000781
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000318256|PACid:22681338
Sequence length 713
Sequence
MSGLNSRHRELKKKRLINYVEEKYLLRPSLPDNPRLKVVNLQQGCYLGNHRAIRLISHHR
TRSLLTAAPIWTPATATYLHRFELYLLRSVCISLHQSHLDFASVCSDQSGFVCINLHLHR
CRTAICLLHLRLHYTFDLHLHQIERRISSFKNNMEKSTTAAILLLLYFFGFCPQPGVPSF
ANPSDDLGKYSLKVPLVFRNFSYVKFVRNATDLPLLEEYDYIVVGGGTAGCPLATTLSAN
YSVLLLERGNIPSAYPNVLRQNETLANFMQEDDGKTPAQRFTSEDGVANLRGRILGGSSM
INIGXYSRADGEFYQKSGIKLDMNLVNNSYEWVENTVAFRPNVTHWQSVVKDAMLEAGVR
PDNGLTLDHILGSKVTATLFDDRGKRHGAVELLNKGHPKNLRVAIHATVERIIFSSKASG
LSAKGIIYSDSNGRSHRALIRGKGEVILSAGAIGSPQLLLLSGVGPKSYLSSRKIPVVHP
QPYVGQFMRDNPRNYITILPPFQVEASTAQVVGITSDYYIETFSGLPFSRQAFSLFPSPT
IPMTINSSFGHIVVKFPGPLSYGSLDLQSSYDVKVAPNVKFNYFAQEADLSRCVSAVRKM
GDLLKTNSLKPYKAQDLPGLEGFNFFGLPLPVNQSDDASFETFCRDTVATFWHYHGGCLV
GQVVDEDLRVMGIKALRVVDGSVFNLSPGTNPQATIMMLGRYXGVQMLEERSE
Download sequence
Identical sequences MDP0000318256|PACid:22681338 MDP0000318256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]