SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000318715|PACid:22666559 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000318715|PACid:22666559
Domain Number 1 Region: 1249-1537
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.59e-78
Family Protein kinases, catalytic subunit 0.0000961
Further Details:      
 
Domain Number 2 Region: 429-742
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.29e-76
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 3 Region: 827-912,944-975
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 7.68e-25
Family alpha-D-mannose-specific plant lectins 0.0024
Further Details:      
 
Domain Number 4 Region: 53-117
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000000017
Family alpha-D-mannose-specific plant lectins 0.0087
Further Details:      
 
Weak hits

Sequence:  MDP0000318715|PACid:22666559
Domain Number - Region: 1131-1177
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00392
Family Hairpin loop containing domain 0.052
Further Details:      
 
Domain Number - Region: 306-353
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0208
Family Anti-platelet protein 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000318715|PACid:22666559
Sequence length 1548
Sequence
MDEKRSIWSVFRDLPMSSVMETRRSSSSGLCRDLQRRERGKADGVDDEGDEVPSNGSAAA
LLDSGNFVVKDDDVGADPLWQSFDYPSDTHLPGMLLGFDSKSGDTNFLTSWKSESDPSTG
MFLVGLTXEVPSQIVVWINGSTPYWRSGPWDKSRYIGLPGTNNGYINGLKLDDNVRQETK
YNFFNFGDTLAYSDISSDGILKLMYSEHGENXILDFVAQNSSCDKYAACGPFGICKRSES
PTTPICKCLKGFAPKSHEEWSKGNRTGGCVRQTKLVCETNTNQSVASRKTEDGFLKMVRL
KVPDFHEYITSLDAXECRTHCLKNCSCLAYAHVNNIGCLVWSKDLIDMQEFAYGGEDLFV
RLDRSELGEGKPIKLISSLTAICLISILGATAFGFQRLRANKKGNARLTDTFKNTRDTLQ
EYIRKHDPSELFIYNFXSILIATNNFSITNKLGEGGFGPVYKGKLEEGKEIAVKRLSSSS
GQGMEEFKNEMLXISKLQHKNLVRIMGCCVKDDEKLLIYEFMPYRSLDTLLFNPTLRAVL
DWSRRFNIIQGVARGXLYLHRDSYLKVIHRDLKVSNILLDEKMNPKISDFGLSRIVEAXQ
SLSXTXKVVGTLGYMSPEYAMXGVFSEKSDVYSFGXLLLEIISGSKNTSFYYSEEQLGFL
AYAWQLWNEGRGLKFVDEVLADSYSSSEVTRCMHIGLLCVQDKAADRPTMPDVVFMLSSE
KDPPPPKQPIFSNFENSSVFDPHPHYDNIFSVDEVNALNFFMFFIFFFSLLLLSRHRCVE
IYEINPSQPLSEGQSIVSPGHVFELGFFSPNNNSGNNKYVGMWHKSIFPRKVVWVANREK
PIAASDTLANLRISNKGNLELVDGKLNSLWSTNISVPSNGSAAALLDSGNFVVKDYDVGA
DPLWQSFDYPSDTLLPSMLLGFDNKSGDTKFLTSWKSESDPSMGMFLVVLTPEVPSQIVI
WINGSTPYWRSGPWDKSKFIGLPCTNDGYLGGFILDDNVRQGPKYYSYNFGDTLAYFDIS
SDGIVKLKCSERGENWILNFVAQNSSCDKYAACGPFGICKSSESPTTPICKCLKGFVPKS
HEEWSKGNRTGGCVRQTKLVCETNTNQSVASRRNEDGFLKVVRLKVPDFHEYIWSSDAEE
CKTRCLNNCSCLAYAYVNNIGCLAWSNDLIDIQEFAYGGQDLFVRLDRSELGEGKPIKLI
ASLTAICLICILGAIAFGFQTLRANKKGNGRLTDTIENARDTLQEYIRKYDPSELFIYNF
DSILIATNNFSITNKLGEGGFGPVYKGKLEEGKEIAVKRLSSSSGQGMEEFENEMLLISK
LQHKNLVRIMGCCVKDDEKLLIYEFMPNRSLDTLLFNPXRRAVLDWGRCFNIIQGVARGL
LYLHRDSYLKVIHRDLKVSNILLNEKMNPKISDFGLSRIVEAAQSLSTTHKVVGTLGYMS
PEYAMGGIFSEKSDVYSFGVLLLEIISGRKSTSFXYKEEQQGFLAYVWHLWNEGRGLKFV
DEVLADSYSLSEVTRCMRIGLLCVQDKAADRPTMPDATFLAIKNTRKL
Download sequence
Identical sequences MDP0000318715 MDP0000318715|PACid:22666559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]