SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000321770|PACid:22645972 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MDP0000321770|PACid:22645972
Domain Number - Region: 291-342
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.000122
Family YicI N-terminal domain-like 0.024
Further Details:      
 
Domain Number - Region: 147-179
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0586
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000321770|PACid:22645972
Sequence length 405
Sequence
MAAGTRAIFAPCISEDLLLHVQSLLYAGVFVKTIMQRHNESVEKQGGPSNRDDLLTHRYV
RRQGNLCGNGVLAQPLKLRLLNEKKPRVYKRVDWLVDKLGTKVHSFFWLDEYSEKDDFAQ
YWKDEWASGLTSWRKALKILNCNIVIDGTCAKVIDEFGICNCHWAEMGNLCEHILKAKTK
NPIEVSVYSGSKLILSHISDSFGSPSRGSPTGRSSSIRAPNPKTHMANWCLRTSTSRYPP
DRRKTPPCTASERTLSHTGSSSTRTIHTPSSLLKSRRSISTLICTGPTRVYMDLQNVGNE
AYAHSFLLLNSNGMDVFYRGTSLTYKVIGGVFDFYFIARPTPLGVVDQDTAFIGRPARMP
YWSLVHINVVPQIRLHLNAIGFSARLPYMKYDVLFTASNGLTYGL
Download sequence
Identical sequences MDP0000321770|PACid:22645972 MDP0000321770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]