SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000321972|PACid:22643109 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000321972|PACid:22643109
Domain Number 1 Region: 28-321,414-461
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.78e-72
Family FAD-linked reductases, N-terminal domain 0.001
Further Details:      
 
Domain Number 2 Region: 303-406
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 9.81e-23
Family L-aminoacid/polyamine oxidase 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000321972|PACid:22643109
Sequence length 493
Sequence
MDPKDPFSAVLFDGSVSSHIERQQNACPSVIVIGGGISGIAAARILHDASFKVLLLESRD
RLGGRIHTDYSFGCPVDMGASWLHGVCNENPLAPLIRRLGLTLYRTSGDDSVLYDHDLES
FALFDTDGHQVPQKMVVEVGDTFKKILRETEKVRNEHTDDMSVSQAISVVMDRHPELRQN
GLAHEVLQWYICRMEAWFAADADVISLKNWDQEHVLSGGHGLMVQGYDPIIKALAKDIDV
RLNHRVTKXLNGSNKVMVTIEDGRNFIADAAIITVPHGILKAKLIEFVPQLPEWKVAAIS
DLGVGNENKVALRFEKXFWPNVELLGIVAPNSYACGYFLNLHKATGHPVLVYMAAGRFAY
DLEKLTDDAAVNFVMLQLKKMLPDATEPVQYLLSRWGTDLNSLGCYALDLVGKPGDIYER
LRAPLGNLFFGGEAVSMDHQGSVHGAYSAGVMAAENCQQHLLKKLGNLETPQHAYLMEEV
LEAATVPLQISRM
Download sequence
Identical sequences MDP0000321972 MDP0000321972|PACid:22643109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]