SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000322228|PACid:22640228 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000322228|PACid:22640228
Domain Number 1 Region: 424-712
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.28e-66
Family Protein kinases, catalytic subunit 0.00042
Further Details:      
 
Domain Number 2 Region: 79-215
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.84e-23
Family alpha-D-mannose-specific plant lectins 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000322228|PACid:22640228
Sequence length 740
Sequence
MDFELASPLCFLLLLLLLPFFTAAQTDQTKNISLGSTLTALHNKSFWASPSGDFAFGFQE
IGKHGFLLAIWFNKIPERTIVWSANGDTLVSKGSAVELTADGRFMLNDVATGKQISVADF
VGTGVSYAAMLDTGNFILANRNSTILWQSFDQPTDTILPLQILNQKGIIFARYTPTNYSK
GRFRFALQSNGQLLLYTTHFPLDSANTTIYWSTDTKDSCFQVIYNMSGSIYLTARNRSIL
HMISSNTVSFQDFYQRATXDYDGVLRHYVYPKSXGTSAAGGNHGLDYXIDPDDVLKGCKK
DFVSQSCDAASPETDQFHFQEMQNTDWPESEYEKNGQCWLKGSPLLNGRVDPINGVKGLV
KIRKDNSTLRSGDRYMKKKDNSTLIMVGTVLLSSSGFLNLLLLLTTYFLVSRFYYGKAKV
GQPHQITNLKNFTHKELEEATNGFKEELGRGAFATVFKGVLGSDEGKCVAVKRLNVMIEE
FDLEFKVELSXISRTNHWDLVELLGFCNEREHQILVYEFMXNNSLASFIFEKSRPNWNRR
KEIAXGITRGLLYLREECSTQIIHCDIKPQNILLDDCYTARISDLGLAKLFKVNQTQTTT
RIRGTRGYVSPEWFKNMPITAKVDXYSYGIMLLEIICCRRNFDKEAKDEDQMVLADWACX
CYKXIKLHLLFQNDDEAMGDIKNMEKYVMIAXWCIQEDPSLRPTTKKLTMMLKGAKQVSV
PTDPSPITSSNQSILSSSTY
Download sequence
Identical sequences MDP0000322228|PACid:22640228 MDP0000322228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]