SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000325860|PACid:22671160 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000325860|PACid:22671160
Domain Number 1 Region: 148-217
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 1.44e-19
Family F1F0 ATP synthase subunit C 0.0048
Further Details:      
 
Domain Number 2 Region: 75-138
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 0.00000471
Family F1F0 ATP synthase subunit C 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000325860|PACid:22671160
Sequence length 227
Sequence
SKSTVLPDSTLSLSQIPKDRIRFIIELLKTELLRLHPNPQIRSRHPIPATIHPHSHTQRY
MASSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPV
VMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDA
GVRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRSGQSRADX
Download sequence
Identical sequences MDP0000325860 MDP0000325860|PACid:22671160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]