SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000336873|PACid:22624796 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000336873|PACid:22624796
Domain Number 1 Region: 2-35
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 0.000000000262
Family F1F0 ATP synthase subunit C 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000336873|PACid:22624796
Sequence length 45
Sequence
RANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRSGQSRADX
Download sequence
Identical sequences MDP0000336873 MDP0000336873|PACid:22624796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]