SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000337735|PACid:22629424 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000337735|PACid:22629424
Domain Number 1 Region: 92-172
Classification Level Classification E-value
Superfamily PA domain 0.0000000615
Family PA domain 0.012
Further Details:      
 
Weak hits

Sequence:  MDP0000337735|PACid:22629424
Domain Number - Region: 510-556
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00105
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000337735|PACid:22629424
Sequence length 627
Sequence
MKEKLGFLVCVWFLLCRVCVGRFVVEKNRLKVTSPSSMKGDYECAIGNFGVPPYGGTLVG
TVYYPKTNQMACKGFEDTDETFKPKPRGLPTFVLVDRGDCYFTTKAWNAQKAGAAAILVA
DDRNEPLITMDTPEEENADAADYLQNITIPSALISKELGDSIKKSLSGDEMVNINLDWTE
ALPHPDERVEYEFWTNSNDVCGPKCDSQIEFVKNFKGAAQVLERKGYTQFTPHYITWYCP
EAFVSSKQCESQCINHGRYCAPDPEQDFSEGYDGKDVVVQNLRQACFYKVANESGKPWLW
WDYVTDFAIRCPMKEKKYNQECANQVIESLGADLKKIQECIGDPEADEENAVLKAEQDAQ
IGKGSRGDVTILPTLVINRVQYRGKLDKGAVLKAICSGFLENTEPAVCLSEDVQTNECLE
NNGGCWYDRAANLTACRDTFRGRVCECPIVQGVKFVGDGYTHCEATGALRCGINNGGCWK
ETRTGSTYSACRDDLTNGCSCPPGFKGDGEKTCEDVDECKEKTACQCAHCKCKNTWGSYD
CSCGGGLLYMRGYDACIGKNASGSGSSRGLIWIIILCLGAVGVGGYIVYKYRIRRYMDSE
IRAIMAQYMPLDNEGAVPGHVSRGDIX
Download sequence
Identical sequences MDP0000337735 MDP0000337735|PACid:22629424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]