SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000379697|PACid:22652172 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000379697|PACid:22652172
Domain Number 1 Region: 99-389
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.77e-75
Family Protein kinases, catalytic subunit 0.0000823
Further Details:      
 
Domain Number 2 Region: 2-31
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000639
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000379697|PACid:22652172
Sequence length 452
Sequence
MGTCINTPGXYTCKCPXGYKNDDPDKIRCIKAXGRAKLXLLLIISLGASGGXLLLLSGSW
IYWGMQRRKFLKLKEKYFKENGGXLLQQKIXSQGGXXETTKIFXAEELEKATNNYHESGI
LGEGGYGIVYKXILAAXNNKVVAIKKSKICVXTQKEQFVNELLVLSQINHRNVVRLLGCC
LELEVPLLVYEFIAHGTLFEHIHGKKRKGSSFSLELRLKIAAETAGALAYLHSSAXMQII
HRDVKXTNILLDENYTAKVSDFGASRLIPLDQAQLATLVQGTXGYLDPEYFXTSQLTDKS
DVYSFGVVLMELLTSKLALDSHRPEGEKNLARFFLCLMEEDRLNEILDDDILNERNIETL
KTVANLAKRCVRLKGEDRPTMKEVAMELEGMRITEKHPWGKDEICSEETECLLGPGNSDA
YPVDVRAGSSTSTTIGYDSMQIQMLIPYDDGR
Download sequence
Identical sequences MDP0000379697 MDP0000379697|PACid:22652172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]