SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000403786|PACid:22642425 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000403786|PACid:22642425
Domain Number 1 Region: 72-167,199-230
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.02e-23
Family alpha-D-mannose-specific plant lectins 0.0053
Further Details:      
 
Domain Number 2 Region: 485-565
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000000000242
Family Protein kinases, catalytic subunit 0.0079
Further Details:      
 
Weak hits

Sequence:  MDP0000403786|PACid:22642425
Domain Number - Region: 364-417
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000102
Family Hairpin loop containing domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000403786|PACid:22642425
Sequence length 581
Sequence
MMNSSRNKLSYMSXVVVFVLCLNLKAAHVSTASGNIISQGQSISGNQTISSSPRGIFQLG
FFTPGNFHNHYIGIWYKKLQKTVVWVANRNHPVSDPFSSSLQLFPNGTLILLDQSKSSIW
STXRDXSVXSNSTSEVAAXLLDNGNFVXXXALNSSAVIWQSFDHPTDTWXXGGKLGYNKL
TNXKLTLTPWRXSQNPAPGIFSLEIERNGTSFLLMYNGTKMYWTSGPWTGKIFKYVPEIQ
LNYLVTNISYKSDEFGSYVSYDAVFPDIFVRYMLDISGQFRAYKWGKDYNQWTSFWLRPS
EHCEVYGFCGASSICNQQQVPLCVCLEGFEPRAPKDWDLEDHTEGCVRKTPLECSTGSGG
NDTFVVIPDLRFPENPETLAGKNIDECRSACLSDCSCTAFAYDSGCLVWKGDLFNVKQLK
SDETVGKELYLRVAASEEPKAKRENKTFWIVIGVLGXXXXXXXXXXXXAKNECSGSGERS
EADEGSLTMFKYRVLRNATKNFTEKLGEGGFGAVFRGTLKSYTAIAVKRLNCPKQADKQF
LTEVRTLGKVQHINLVRLHVWMQISAFFFLDKIVPTKQLTH
Download sequence
Identical sequences MDP0000403786 MDP0000403786|PACid:22642425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]