SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000440896|PACid:22680420 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000440896|PACid:22680420
Domain Number 1 Region: 42-139
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.09e-40
Family GDI-like 0.0001
Further Details:      
 
Domain Number 2 Region: 140-183
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000777
Family GDI-like N domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000440896|PACid:22680420
Sequence length 194
Sequence
MLSKPECKVEFENGKAIGVTSEGETAKCKKVVCDPSYLPNKVKIVGKVARAICIMSHPIP
NTNDSHSVQVILPQKQLGRKSDMYLFCCSYSHNVAAKGKYIAFVLTEAETDNPQVELKPG
TDLLGAVDEIFFDTYDRYEPTNQGDGDNCFISASYDATTHFETTVQDVIAMYSKITGKAL
DLSVDLSAASAAEE
Download sequence
Identical sequences MDP0000440896 MDP0000440896|PACid:22680420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]