SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000444049|PACid:22680362 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000444049|PACid:22680362
Domain Number 1 Region: 78-388
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 2.01e-104
Family AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC 0.00000252
Further Details:      
 
Domain Number 2 Region: 743-1030
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.13e-70
Family Protein kinases, catalytic subunit 0.00024
Further Details:      
 
Domain Number 3 Region: 392-503
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 9.68e-24
Family alpha-D-mannose-specific plant lectins 0.0039
Further Details:      
 
Domain Number 4 Region: 5-63
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 0.0000000192
Family Inosicase 0.003
Further Details:      
 
Weak hits

Sequence:  MDP0000444049|PACid:22680362
Domain Number - Region: 626-682
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000981
Family Anti-platelet protein 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000444049|PACid:22680362
Sequence length 1089
Sequence
MFVNQNHKDVLVVVDSEDYPALLEFLKGDKDDQQFRRKLAWKAFQHVASYDSAVSEWLWK
QTSEDKFPQSLTVPMLLKSPLRYGENPHQKAAFYVDKSLSEVNAGGIATAIQHHGKEMSY
NNYLDADAAWNCVSEFQNSTCVVVKHTNPCGVASRDDILEAYRLAVKADPVSAFGGIVAF
NVEVDEALAKEIREFRSPTDGETRMFYEIVVAPKYTKKGLEILRGKSKTLRILEARKNEK
GKLSLRQVGGGWLAQDSDDLTPQDIQFKSVTEKAPQKSELADAEFAWLCVKHVKSNAIVI
AKNNCMLGMGSGQPNRLESLRIALKKAGEEVKGAALASDAFFPFAWKDAVEEACESGVSV
ITEPGGSIRDGDAIDCCNKYGVSLLFTNNIPIQTVVWVANRKQPVSEPKLSVLELVENGN
LTLSSPSKAAVWSTNSRSKVSNSSVAKLLDNGNFVITDAFDSSAVIWQSFDHLSDTWLPG
SELGYNNRTKRKLVLTSWRSVENPAPGPFSFELYELPFNLSDYPNDLFRGTLEINGQLKF
YAGYQTYWEWTLISTEPSDQCEVDVSCGAFSICNQLSSRCVCLEGFEPKVLENWRLQDFS
DGCARKTPFHCSPGDSFLAIGGVEYPKNFKEIFHVSLGECRLECLIDCSCTAFAYEFPDS
RRCYMWTGDLCNLRATYRSDFTSYYPDSTGFYLRIVDSKNATTRKTTWIVIGVLVGFFCI
LISTFIVMVFFRRRWSAGALATTGDSLVLYKHRDLRRATNNFSQKLGEGAFGSVFKGMLP
NSTAIAVKELKSMNQGEKQFRAEVGTIGVIQHINLIRMRGFCVSASKRFLVYDYMPNGSX
QSLLLGKNPTMLDWKARYHIAVGTARGLAYLHEECRDCIIHCDVKPENIXLDSEYSPKLA
DFGLAKLLGRHHSRVLTTMRGTVGYLAPEWFSGEAITPKADVFSYGMVLIEVISGRRNRE
GLDDGVENFRPIRXANAVNKGEDLFALLDCRLEGQADGDELSRACKVACWCIQEDEKDRP
XMKQVVQILEGVSDIXVPPVPRFLQRLIGGPSEGINNQETTSGSGSWSCSDVQSAFQAEV
SNCAFQATH
Download sequence
Identical sequences MDP0000444049|PACid:22680362 MDP0000444049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]