SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000454459|PACid:22670266 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000454459|PACid:22670266
Domain Number 1 Region: 74-183
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.84e-29
Family alpha-D-mannose-specific plant lectins 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000454459|PACid:22670266
Sequence length 235
Sequence
MGGLCFSFMISANLFFLSSTISFAVDGFTPSQCVLDGTTLVSSDGSFELGFFSPGSSKNR
YLGIWFKNVPVRTVVWVANRCNPINDTSGVLMINSXGNLVLLSQNSSVVWSTSLVKQAQN
ATVELLDSGNLVLRDAKDGNSGTYLWQSFDYPSDTLLPGMKVGWDLRTGLKRHLSAWKNS
DDPCPGDFTYGIEMQLQAYPEAYILNGSTKFFRTSAWNELTICGSPEHPSPRYSC
Download sequence
Identical sequences MDP0000454459 MDP0000454459|PACid:22670266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]