SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000458203|PACid:22662800 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000458203|PACid:22662800
Domain Number 1 Region: 489-779
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-68
Family Protein kinases, catalytic subunit 0.00024
Further Details:      
 
Domain Number 2 Region: 66-211
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 9.29e-27
Family alpha-D-mannose-specific plant lectins 0.0029
Further Details:      
 
Weak hits

Sequence:  MDP0000458203|PACid:22662800
Domain Number - Region: 336-390
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000451
Family Pan module (APPLE domain) 0.04
Further Details:      
 
Domain Number - Region: 286-317
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0188
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000458203|PACid:22662800
Sequence length 799
Sequence
MKHQHVRCFLTFAFITLFSHSSSAIPKTRNRLSRGSSISVQDXSDFLTSPDESFTCGFYG
VGTNXFWFSIWFTKSIDRAVVWTANRDRPVNGLGSRLSLRRDGAMVLTDDDGTAVWGTTV
NSRADTAVLLDSGNLVLKDKRGKVLWQSFDIPTHTLLPNQPFTKSKKLISTLGKGTFGTG
YFSFSFDNDNVLKLMFDGPDTSSLYWPDPDYNVFAGGRTNYNSXRVAVLDELGNFXSSDX
LQFTASDAGSSAKRRLTMDYDGNLRLYSLESTTGLWVVTWEAMTELCKVHGICGRNGICI
NTPQPKCSCPPGYEVADTSDWKEGCKPMFNRXYLRSQQXKFVQIEQVDFYGFDLNYSEPT
TFENCTNLCLDDXRCEGFSYRIXEAKCFTKSALFNGYKSPNFPGSMYIRLPXSVKTSXPV
NLNASNTCRKNVTKVVPSXYGSTXRRVKWVYMYXFAFAIGALEVLFIASAWWLLFRRHSA
AAPTEDGYHIISSQFRKFRYAELKKATKNFKEELGRGASGAVYKGVLADERVVAVKKLAD
IYHGEEVFWAEVSTIGKINHMNLVRIWGFCSDKKHKLLXSEHVENGSLDKHLFPPINFLG
WQERFKVAIGIAKGLAYLHHECLEWVIHCDVKPENILLDGNFEPKIADFGLAKLTQRGNL
SSVXSQIRGTKGYMAPEWAXNLPITAKVDVYSFGVVILELVKGIRLSSWVVEDTDDLETE
LTRFVRVAKRKIQCGKDLWIEDMMDPRLNGQFSRIQAAKMVEIGISCVEEEKSKRPTMDS
EKKNRTRVQEADILPWLLA
Download sequence
Identical sequences MDP0000458203|PACid:22662800 MDP0000458203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]