SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000465085|PACid:22678515 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000465085|PACid:22678515
Domain Number 1 Region: 252-540
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.05e-72
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 137-182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000865
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 3 Region: 662-712
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000726
Family Protein kinases, catalytic subunit 0.011
Further Details:      
 
Weak hits

Sequence:  MDP0000465085|PACid:22678515
Domain Number - Region: 105-144
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00164
Family EGF-type module 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000465085|PACid:22678515
Sequence length 739
Sequence
MSKCDNLGNAINRRDTCSGVGCCQTKIPSGLKNRTVTLGSFNNYTYVLDSHRCSYAFLVQ
EGEFNFNSTSDRELNDTTQRPAIIDWVIGNESCDIAAKNESTFACKANSYCHNRSSGGYI
CRCRSGYEGNPYLPGGCQDIDECKAPDSCGNGTCINKAGGHSCLCPKGYIYDPDEKSCIK
DNGRADNGRAKLSLPLIISLGASGGFLLLLSASWIYWGMQRRKFLKLKAKYFKENGGLLL
QQKIASQGGSVETTKIFTAEELEKATNNYHESRILGEGGYGIVYKGILAADNNKVVAIKK
SKICVPTQKEQFVNELIVLSQINHRNVVRLLGCCLELEVPLLVYEFVAHGTLFEHIHGKK
RKGSSFSLELRLKIAAETAGALAYLHSSALMQIIHRDVKXTNILLDENYXAKVSDFGASR
XIPLDQAQLTTLVQGTFGYLDPEYXLTNQLTDKSDVYSFGVVLMELLTSKXALAFDRPEX
ERNLANFFVCLMXEDRLNXILDDDILNXRNIETIKTVANLAKRCVRLKGXDXPTMKEVAM
ELXGMRITEKHPWGKAEICSEETECLLGXXNSDAYPVDVRAXCGPSTXTTIGYDSMQIXX
KWWLVVTTTTRESTRRDRWRQQQSLQQKDLRRPQTTTMRAEELKAVKSRKSELQPKCGEA
SSAGELFDHLHSIKSKESTLSRELRLKIAAETAGALAYLHSSTSMPIIHQDVNIIGRKLL
RHTRNEIHSKHNIFKIQAD
Download sequence
Identical sequences MDP0000465085|PACid:22678515 MDP0000465085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]