SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000486055|PACid:22674710 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000486055|PACid:22674710
Domain Number 1 Region: 67-181
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.88e-21
Family alpha-D-mannose-specific plant lectins 0.0069
Further Details:      
 
Domain Number 2 Region: 444-516
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000000000073
Family Protein kinases, catalytic subunit 0.0044
Further Details:      
 
Weak hits

Sequence:  MDP0000486055|PACid:22674710
Domain Number - Region: 511-579
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00538
Family Protein kinases, catalytic subunit 0.017
Further Details:      
 
Domain Number - Region: 344-416
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.049
Family Pan module (APPLE domain) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000486055|PACid:22674710
Sequence length 610
Sequence
MNVHRSSEGRLTPLLLNGSASADSLPPTNGDVLLSTTKIFALGFFSPGDSHNRYVGVWYN
KIPIQTIVWTANRDNPIIPISGAGLLAIHGDHGGLVIYGKDQNTXLWSANVXVSSPNNXX
IAKLLDTGNLVLLENNGSSQTVLWQGFDYPSDTVLPLMKIGLNRRSGLNWILKSWKSHDD
PSSGTFSYEIDPTGFLQVIMYNGRTKWFRAGPWTGKXLSGLPEITSNSHRSFVNNKDETY
LVYTVPNGSVFTRGVVDESGTFQRFVWRGQENKWIEVSSNPSEWCDYYGQCGPNSNCDPY
SNYNFSCLCLPGFEPKFPRDWSLRVGWGXCLRKSGASTCQKGEGFVKVAHVKVPDTSWAR
VNMSLSLKGCEQECRKNCSCTAYTSADERDGGKGCVTWYGDLIDARTFSNVGQDLYVRVD
AATLAGRQRKNTFFMEDRTDLDDQSNINSELPFFDLTTIAAATGNFSVANKLGKGGFGSV
YKGVLHNGKEVAVKRLSKHSGQGIEEFKNEVWNLWREGNALETVDPSMGESYHVNEVVRC
IQIALLCVQEFSADRPTMSAVVFMLGNDVAVPSPKQPAFLLRNCTSGDPSTSTEGAGSTN
DVTCTEVEAR
Download sequence
Identical sequences MDP0000486055|PACid:22674710 MDP0000486055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]