SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000519318|PACid:22679736 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000519318|PACid:22679736
Domain Number 1 Region: 99-386
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-71
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Domain Number 2 Region: 2-33
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000113
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000519318|PACid:22679736
Sequence length 483
Sequence
MGTCINTPGKYTCKCPKGYKNDDPDKIRCIKANGRAKLSLLLIISLGASGGXLLLLSGSW
IYWGMQRRKFLKLKEKYFKENGGXLLQQKIXSQGGXVETTKIFXAEELEKATNNYHESXI
LGEGGYGIVYKXILAADNNKXXAIKKSKIXVPTQKEQFVNELLVLSQINHRNVVRLLGCC
LELEVPLLVYEFXAHGTLFEHIHGKKRKGSSFSLELRLKIAAETAGALAYLHSSALMQII
HRDVKLTNILLDENYTAKVSDFGASRLIPLDQAQLATLVQGTIGYLDPEYFHTSQLTDKS
DVYSFGVVLMELLTSKXALDSHRPEGEKNLARFFLCLMEEDRLNEILDDDILNERNIXTL
KXVANLAKRCVRLKGEDXPTMKEVAMELEGMRITEKHXWGKXEICSEETECLLGPGNSDA
YPXDVRAGSSXXAGDHLIWVGEQSKPDASDPTTERSQTVQSFPSWSGTNRELQYGHDTSF
CPR
Download sequence
Identical sequences MDP0000519318 MDP0000519318|PACid:22679736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]