SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000538536|PACid:22660707 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000538536|PACid:22660707
Domain Number 1 Region: 482-781
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.05e-73
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 
Domain Number 2 Region: 64-195
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.31e-23
Family alpha-D-mannose-specific plant lectins 0.0027
Further Details:      
 
Weak hits

Sequence:  MDP0000538536|PACid:22660707
Domain Number - Region: 161-238
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00224
Family alpha-D-mannose-specific plant lectins 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000538536|PACid:22660707
Sequence length 786
Sequence
MFLPFSTLAQTSKNISLGSSLTALNDDNSSSWXSPSGDFAFGFQRIGKDGFLLAIWFDKI
KDKTIVWSANGDNLVPEGSKVELSIGGELMLTDATGKRIWSAQSVSPGVAYGSMLDTGNF
VLADRSSSNVWESFDKPTDTILPTQILNQNDILFARYMATNYSRGRFMFILQSDGNLLLY
TTRFPLPTNNFAYYATMTMSTGFQVIFNQSGYLYLTAKNGSILNMVSSNTVSMQNFYHKV
TLEHDRVLRHSVHPKTAASSAGSPMAWSPLTSEPSDICLRIGGDTGSGACGYNSLCSYDD
KGPTCQCPYGYTFIDPNDXLKGCKQNFVSQSCDEALPETESFDFHEMQNTEWAGGXYEQF
TSVPEEWCRQNCLDDCFCVVAIFKDGXCEKKRIPLSNGRMXPSIGGKALVKVRKDNSTFI
PEVPNTKKKDYSTLILIGSVLLSSSGFLNLILLLTTYLAVSRISYRKVNLSEPNYPVISD
MNLKHFTYEELRNATNEFEDELGRGASAIVFKGVLATDNEKSVAVKSLVARVGENDLEFK
AEMSSIGRTNHRNLVQLLGFCYEGEHRMLVYEFMSNXSLASFLFGELRLSWYQRRKIALG
IARGLLYLHEECCSQIVHCDIKPQNILLDDSFXARISDFGXAKLLRMDQTRTTTGIRGTK
GYVAPEWFNRLPITAKVDVYSFGILLLEIIFCRKHFEPTAEDEDQMILADWAYDCYKQNN
LHQLFKNDDEAMHDIKKMEKYVMIAIWCIQEDPSLRPTMKKVALMLEGTVEVSAPPDPCS
FISSII
Download sequence
Identical sequences MDP0000538536 MDP0000538536|PACid:22660707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]