SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000562189|PACid:22622279 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000562189|PACid:22622279
Domain Number 1 Region: 56-138
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000000000413
Family Protein kinases, catalytic subunit 0.0068
Further Details:      
 
Domain Number 2 Region: 12-62
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000000353
Family alpha-D-mannose-specific plant lectins 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000562189|PACid:22622279
Sequence length 149
Sequence
MSRGHRDRGVSGGKRGFAIELQDSGNLDLHGDDGGVVWQSFSHPTDTLLWNQEFSEGMKL
LGQRGFASVYQGILPDGTRLAVKKLEGIGQGQKEFQAEVTIIGSIHHLHLVWLRGFCANG
SLDKWIFMKYNKESLLDWEDKVQYSNVYS
Download sequence
Identical sequences MDP0000562189 MDP0000562189|PACid:22622279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]