SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000565228|PACid:22683104 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000565228|PACid:22683104
Domain Number 1 Region: 28-66
Classification Level Classification E-value
Superfamily Cupredoxins 0.00000568
Family Plastocyanin/azurin-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000565228|PACid:22683104
Sequence length 209
Sequence
MIKAMNFRNVMVLAIAVATVXTMSHTTAATEYVVGDDLGWTVPPGGAAYYVSWAANHSFV
LNDXLXKFLNAKRATTRRLWHGHMRRQRAGRVDGGLTAIRNILSSSPVVLAIHRRLNSPE
SGKSSWFMGKFSNLWSPKNGRMWPENGLKYLTKIGLLETRLFRRQSFFKIVLGASGSCKR
ASASPKMQLMKKIPVDVNLQKLNLHLVSV
Download sequence
Identical sequences MDP0000565228|PACid:22683104 MDP0000565228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]