SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000576268|PACid:22668113 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000576268|PACid:22668113
Domain Number 1 Region: 21-111
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 4.64e-20
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000576268|PACid:22668113
Sequence length 122
Sequence
MSIHVPMYLASGLLAMLQTDIPPLSVVGLTEEQAIEQAKGDILVFTSTFNPMKNTVSGRQ
EKTIMKLIVDAETDKVIGASMCGPDAAEIMQVGIHPSSAEEFVTMRSATRRIAAGTKPKT
NL
Download sequence
Identical sequences MDP0000576268|PACid:22668113 MDP0000576268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]