SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000596064|PACid:22633854 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000596064|PACid:22633854
Domain Number 1 Region: 498-793
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.71e-78
Family Protein kinases, catalytic subunit 0.00022
Further Details:      
 
Domain Number 2 Region: 67-203
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 9.95e-22
Family alpha-D-mannose-specific plant lectins 0.0071
Further Details:      
 
Weak hits

Sequence:  MDP0000596064|PACid:22633854
Domain Number - Region: 177-274
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0641
Family alpha-D-mannose-specific plant lectins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000596064|PACid:22633854
Sequence length 913
Sequence
MAMPVFLHLLGLLLVVXEPLCAAAQSAANISLGSSXTASEDTSKSSWQSPSGTFAFGFRR
XGDQXTFLLAIWYDXIPDKTVVWYANGDAPAPKGSKIELTADGQFALTGPKXQEIWKPES
VLSGGVAYAAMLDTGNFVLAGXNSDYLWQSFKDPADTILPTQLLEIGEKLYSRQTASNYS
RGRFQLQVKQDGRLVLYPVALPTEFAYXTYYXSNTADAADXMNTGFQLLFNESGYLNIVX
RNGSMVSLTNKXVSPXRDYYXRATLDFDGLFTXYAHPKSXKNGSWTSWLPLWSIPDNICF
XVNGDLGSGPCGYNTVCRLDANRRPICECLPGFSALDSXNKFGGCKQNXIPTCEQGNSKL
EELYVMHELTNTYFPSSANYEQIQPMNXDDCTRSCLYDCNCMVAVVKEGSCWKKKLPVSH
GRQDWNTYGXALIKLPKSDAALEDPLFPVSDTGKKDQKTLILVGGLLLGSSVVLNFIFLA
AISLVFFYGYKKRHNLTSSASSIMEANLRSFTYKDLEEATDGFREELGRGAFGIVYKGII
SSISSTNYVAIKKLDKMAQEGEKEFKAEVRAIARTHHKNLVRLLGFCDEGPNKLLVYEFM
SNGTLASFLFGISRPDWNKRIQIAFGIARGLMYLHEECSMQIIHCDIKPHNILLDDSFTA
RISDFGLAKLLLSDQTLTNTVIRGTRGYVAPEWFRNIPITAKVDVYSYGVMLLEIICCRR
SLEMERENEEEVILTDWVYDCYKEKTLKKLIEDDEEARNDMKRLERLVRVAIWCXQEDPS
LRPTMKKVTQMLEGVVDVSVPPWTTSSGSICRVQRDKTKGARRDARVLSSLEELDFEXSN
WSLXGPLQPVVIKNNTTWMDSGESTMFFSLPSVMSSSLVIVSVTWLRLLMDFLRSTVKLT
VNGGEDTMQASGI
Download sequence
Identical sequences MDP0000596064|PACid:22633854 MDP0000596064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]