SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000613706|PACid:22635493 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MDP0000613706|PACid:22635493
Domain Number - Region: 3-64
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000113
Family Protein kinases, catalytic subunit 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000613706|PACid:22635493
Sequence length 86
Sequence
MVDLPRWVKSVVLEEWTAEVFDLELLKQQHSEEEMVQMLQIALACVTKLPETRPNMDEVV
RMIEEFRQSDTKTRQSSESKFDVQTP
Download sequence
Identical sequences MDP0000613706 MDP0000613706|PACid:22635493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]