SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000619993|PACid:22646195 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000619993|PACid:22646195
Domain Number 1 Region: 165-264
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.22e-22
Family alpha-D-mannose-specific plant lectins 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000619993|PACid:22646195
Sequence length 277
Sequence
MKDLINPQLITMCSSTNGFGQGTSKYHFAREGPFLEIACILIVWNLWRESNALEIIDSPL
GELDHVNQVLICHGPAKMSAVAFMLSNEEAAPSPKQPASELLIFLVIPPSSISVALDAIT
PNQPLRYGDVLLSATKIFALGFFSPGNSHNRYIGVWYNNIPIQTIVWIANRDNPITPIAG
TWLLAIHGDHGGLVIYGKDQNNPLWSANVTVSSPNNSVIAKLLDTGNLVLLENNGNSPRV
LWQGFDYPSDTLLPLMKIGLNRRFRAEQALNISEVSG
Download sequence
Identical sequences MDP0000619993 MDP0000619993|PACid:22646195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]