SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000620276|PACid:22647009 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MDP0000620276|PACid:22647009
Domain Number - Region: 23-49
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 0.0107
Family F1F0 ATP synthase subunit C 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000620276|PACid:22647009
Sequence length 81
Sequence
MGAMYGMTKSRVGVVSMGVMRLELVMKSIVPVVMAGVLGIYGLIIAVIIDTGINPKAKSY
YLFDGYAHLSMKWVESKXEGE
Download sequence
Identical sequences MDP0000620276|PACid:22647009 MDP0000620276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]