SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000627319|PACid:22624067 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000627319|PACid:22624067
Domain Number 1 Region: 497-792
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.43e-77
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 801-895
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.69e-17
Family Protein kinases, catalytic subunit 0.0051
Further Details:      
 
Domain Number 3 Region: 66-215
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.49e-16
Family alpha-D-mannose-specific plant lectins 0.0035
Further Details:      
 
Weak hits

Sequence:  MDP0000627319|PACid:22624067
Domain Number - Region: 177-291
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0014
Family alpha-D-mannose-specific plant lectins 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000627319|PACid:22624067
Sequence length 945
Sequence
MAVALSVRMLLFFSLFLLPXSVFSQNNGRVAVGSSLTASTGDSSSWLSPSGDFAFGFSPL
GNNDXFLLSIWYAKIPETIVWHAYDDNNPXXAPXGSXXXLTANXGLVLNNPQGGEIWKSE
TTFGIVENGVMNDTGNFVLQDKNSXSLWETFSNPTDTVLPGQTIEKNGKLSXRQSETNYT
KGRFQLRLQDDGNLVLNTVNLPTDFANNPYFATDTXAGTVEGSQGKQXVFNSSGYMFVLR
ENGGRXTLTGPQGVSTRDNYIRATLDFDGIFTLYSHPKNFTGNPSWSSPLWXXPDDICQX
LXEDXGVGVCGYNSVCKLXPDSNRPTCECPXGFSFLDPKDIYRGCKPDFIQGCEEDELQG
PRNDLYXVQVLTNTDWPTSDYVQLKPSTADKCNESCFQDCLCAVAVFRSETCWKKKLPLS
NGRVDVSLNSQTFIKVRKDNVTLPFPPKPIXDDKEKSRKSVIRVESVLLGTSIFVNFXLS
SALCFGIFFIFRKKPVTSSTDIVLDSNLRSFXYEELREATNGFTEELGKGAFGVVFKGVM
QIGSGVEVAVKKLNYVMQDVEKEFKTELKVIGQTHHKNLVRLFGYCDEGQQRLLVYEFLR
NGTLASFLFSDIKPSWRQRIDIAYGVAQGLLYLHEECSTQIIHCDIKPQNILLDDYYTAR
ISDFGLAKLMLMNQSQTHTAIRGTKGYVAPEWFRNLPITTKVDVYSFGVVLLEIVCCRRS
VDMEGNCEESAILTYWVYDCYVEGGLDAVVDYEVEALGDRTTLEKFVMVAIWCIQEDPSL
RPTMRKVVQMLEGVVEVPVKPSWRQRIEIAYGVARGLLYLHEECITQIXQCDIKPENILL
DDYYNARISDFGSPILTMNQSQIHXAIRRAKGYVACAHEWFRILRITIKVGVYSFDVHET
FWELTGFGFRMNSEVKQKGGQNTPRMGDPVGSCSWVPKNKTVREW
Download sequence
Identical sequences MDP0000627319 MDP0000627319|PACid:22624067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]