SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000633820|PACid:22654547 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000633820|PACid:22654547
Domain Number 1 Region: 480-765
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-76
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 2 Region: 74-169,201-232
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.27e-24
Family alpha-D-mannose-specific plant lectins 0.0043
Further Details:      
 
Weak hits

Sequence:  MDP0000633820|PACid:22654547
Domain Number - Region: 373-416
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00106
Family Hairpin loop containing domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000633820|PACid:22654547
Sequence length 810
Sequence
MDMMNSGRNKISYKSLVVVLVFCCTLKAADISAASSNMISQGQSISGNHTITSSPRGIFE
LGFFTPGNSNNYYIGIWYKNVQETVVWVANRNHPVSDPFLSSLQLFPNGTLALFDQSKSX
IWSTTRDLSIASNSTSQVAAILLDSGNFVITDALNSSAVIWQSFDHPTDTWLPGGKLGYN
KLTNEKLTLTPWRSSQNPAPGIFSLDLEQNGTSLLLMYNGTRMYWTTGPWTGKIFTKVPE
IQLNYLITNISYVSNELGSYFSYDAVYPDIFVKYMLDISGQLRASKWGRDFHQWTSFWLR
PSEQCDVYGFCGASSICNQQQVPLCVCLEGFEPRSPKDWDSADSWEGCVRKPPLECSSGG
NETFVVIPDLSFPENSETLAGKNIDECRLACLSDCSCTAFAYDSRCLVWKGDLFNVKQLT
SDENVGKEWHLRVPKAKKENKTLWIVTGVLGGLLGILLVIVVIAKNKCSGSGERSEADDG
SLMMFKYRILRKATKNFTEKLGEGGFGSVFRGTLKNSTAIAVKRLNCPEQADNQFLTEVR
TLGKVQHINLVRLRGFCAETSKRLLVYDYMPNGSLESLLFQKSPIVLDWKTRYHIAVGTA
KGLAYLHDSCRECIIHCDIKPENILLDAEYAPKITDFGLAKLMSRDFSRIITTIQGTRGY
IAPEWISGEAITVKADVFSYGMLFFEIISGRRNRDLLDDGLENYFPTHVANVLTKGENVD
TLLDSRLEGNANKEELMRACKVACWCIQDDEKDRPTMGQVVQALEGVIDLGMPPVPHFMD
RFSKSHFESIHYHDISSSTASDSRRGYSSN
Download sequence
Identical sequences MDP0000633820 XP_008381604.1.92800 MDP0000633820|PACid:22654547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]