SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000635687|PACid:22654116 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000635687|PACid:22654116
Domain Number 1 Region: 470-759
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.5e-77
Family Protein kinases, catalytic subunit 0.00019
Further Details:      
 
Domain Number 2 Region: 82-214
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.93e-20
Family alpha-D-mannose-specific plant lectins 0.0039
Further Details:      
 
Weak hits

Sequence:  MDP0000635687|PACid:22654116
Domain Number - Region: 351-384
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0981
Family Pan module (APPLE domain) 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000635687|PACid:22654116
Sequence length 796
Sequence
MGDWNFIHLNHFTGFIFLSVILLASETCLALVRNFGTINPPFQGAQINWIDNGGLFLLSN
RSEFGFGFKRFETSPQDRLFLLVIVHMDSSRVVWTGNRGSPVLNSDKFVFDAKSGVFLQS
DGGVVWSADTGGKRVSAIELQDSGNLVLHGDDGGVVWQSFSHPTDTLLWNQEYTEGMKLV
SNPSSNNLSCILHIKSGDLVLSAGYQTPQPYWSMTKENRKTINKDGGVXTSATISENSWK
FFDRSKALLWQFIFSSNIDSNATWIAVLGKGQLILQEQKYQAIRAAHQNLVIHTSSVLVT
RTASALQVSARVVIARRGLSPHVILQGGSTELVNAGDGLYYFALGYIPASSKTDLNGCQT
SCLGNCSCVALFFQNSTRNCFLFDKLGSFQNSDKGSGFVSYIKVLRDGSSGTGASRSSKK
RFPYVVIIAISTVLAIICGLLYMGCRYYWKKRKSPESPTETSEEGNFFENLTGKPIRFSY
KDLQTATNNFSVKLGQGGFGSVYHGILPDGTRLAVKKLEGIGQGQKEFQAEVTIIGSIHH
LHLVRLRGFCAEGSHRLLAYDYMANGSLDKWIFKKYNKESLLDWETRFNIALCTAKGLAY
LHEDCDSKIVHCDIKPENVLLDDNYLAKVADFGLAKLMTRGQSHVFTTLRGTRGYLAPEW
INNSPISEKIDVYSYGMLLLEVIGGRKNYDRTETSEKSNFPSYAFKMLGEGKLKDIVDTK
LGIDKGDKRVETAIMVALWCIQEDMSLRPSMTKVVQMLEGLLPVPQPPTSAARGSQLYTD
VFKSDNNSAVCLSGPR
Download sequence
Identical sequences MDP0000635687|PACid:22654116 MDP0000635687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]