SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000660436|PACid:22636436 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000660436|PACid:22636436
Domain Number 1 Region: 483-769
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.07e-74
Family Protein kinases, catalytic subunit 0.00017
Further Details:      
 
Domain Number 2 Region: 78-186
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 9.16e-26
Family alpha-D-mannose-specific plant lectins 0.0041
Further Details:      
 
Weak hits

Sequence:  MDP0000660436|PACid:22636436
Domain Number - Region: 357-413
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000326
Family Anti-platelet protein 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000660436|PACid:22636436
Sequence length 835
Sequence
MDAKTKQRLVLSVLFFCYLKTHVSLAXDSITAXQSLSGXQTXXSAAGIXELGFFNPGNSS
NFYIGMWYTKQVVSERTIVWVANREKPVSDRFSSVLRISDGNLVLXNESKTPIWSTNLTS
SSATTARLLDTGNLVLXSGSGNXTSEXLWQSFDHPAHTWLPGGRIGFNXVTKQTQILTSW
KSSEDPAPGLFSLELDPNGSNAYLILWNRSRQYWTSGSWDPKSRIFSLVPEMRLNYIYNF
SYFTNETESYFTYSVYDPKRISRFVMYTSGQIQQLTWLDTSRQWNLFWSQPRKQCEVYDL
CGAFGSCNEESNLACNCLNGFEPKSKRDWDLMDYSGGCSRKTRLYCENATSANGKPDQFL
ELPSMSLPENEQSVEVGSFAECESFCLRNCSCTAYAYNRSGCSFWKGELLDLQQLKSSDD
QGRTLYLKLAASEFKSSKSNKGLIVGVVAGSTAGVAVLLGLIVFAILRRRKRVKGLGKAV
EGSLVAFGYRDMQDATKNFSEKLGGGGFGSVFKGTLPDSSVIAVKKLESVSQGEKQFRTE
VSTIGTIQHVNLVRLRGFCSEGSKRMLVYDYMPNGSLDSHLFNDKGPGLLDWKTRYQIAL
GTARGLAYLHEKCRDCIIHCDIKPENILLDAELCPKVADFGLAKLVGREFSRVLTTMRGT
RGYLAPEWISGVPITVKADVYSYGMMLFEFVSGRRNSEQSEDGKVRFFPAYAASQISTPE
SDVLSLLDPSLDGNADVEELTRVCRVSCWCVQDDEAQRPSMGQVVQILEAVSDVNLPPIP
RALQLFGDDQEQIVFFTESSSSQSSRPRSNNTSTASSQTKSTPSSTISKGSKEHQ
Download sequence
Identical sequences MDP0000660436 MDP0000660436|PACid:22636436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]