SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000673192|PACid:22675970 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000673192|PACid:22675970
Domain Number 1 Region: 83-209
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 9.03e-23
Family alpha-D-mannose-specific plant lectins 0.0036
Further Details:      
 
Domain Number 2 Region: 174-274
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000122
Family alpha-D-mannose-specific plant lectins 0.005
Further Details:      
 
Weak hits

Sequence:  MDP0000673192|PACid:22675970
Domain Number - Region: 314-354
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00745
Family Anti-platelet protein 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000673192|PACid:22675970
Sequence length 450
Sequence
MPELVEHLRKSRLLLCIFVAFLLNTLATSDIPLGSKISVADKTIWISPNGDFAFGFFNRS
DQPNYSFGIRLISKSFPLDQQLLVWSAAADLIIGNNSYAQLTQDGELVLFDSLKGVTAWT
SKTRQLSVVSAALNDNGNLVLLNQEKHIVWQSFDTPSDILLPGQSFSTLQTLRAASKNCV
SSYYTLFMSASSQLQLQWESHVTYWRSGSLSSSNLSAFITSDGALQLRDQSLKPVWSLYS
QDHNDSISYRFLRLDVDGNLXLYSWVEDSKSWRSVWQAVENQCDVFATCGQRGICVFNES
GSPDCECPFKQQTNESTSRFAKVSLEECKSXCQNDLTCTAATFSNDGTARCLIKRTPXVT
GYSDPSLSXVSYAKMCADPLAAVRRFISSGKDNSLGHDLRPSILSDVKLINHXGKADGGD
RSKTGLCSKMCLAXLTRHHLTERQMERLXS
Download sequence
Identical sequences MDP0000673192|PACid:22675970 MDP0000673192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]