SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000677249|PACid:22637735 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000677249|PACid:22637735
Domain Number 1 Region: 79-147
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 0.000000000000017
Family F1F0 ATP synthase subunit C 0.011
Further Details:      
 
Weak hits

Sequence:  MDP0000677249|PACid:22637735
Domain Number - Region: 22-65
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 0.000301
Family F1F0 ATP synthase subunit C 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000677249|PACid:22637735
Sequence length 155
Sequence
MSGAAIAVGYSSSWARALVQISPYTFSAIGIAVAIGVSVLGAACVIFCEAVAIYGVIVAI
ILQTKLESVPTSKMHAPESLRAGYAIFASGIIVGFANLVCGLCVGIIGSSCALSDAQNSS
LFVKILVIEIFGSALGLFGVIVGIIMSAQATWPSK
Download sequence
Identical sequences MDP0000677249|PACid:22637735 MDP0000677249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]