SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000694227|PACid:22673619 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000694227|PACid:22673619
Domain Number 1 Region: 32-132,180-210
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000000181
Family FAD-linked reductases, N-terminal domain 0.00016
Further Details:      
 
Domain Number 2 Region: 116-167
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.0000051
Family L-aminoacid/polyamine oxidase 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000694227|PACid:22673619
Sequence length 913
Sequence
MELAIDFTLHDFEMPEVEPISTFLDYGEREFLVADERGYEHLLHKMAEDFLFNSEGKLLD
SRLKFNKVVRELQHXRNGVTVMTEDGCIFQANYMILSVSIGVLQSDLIAFNPPLPESKRV
EAQSDEETLKEAMGALTDMFGPNIPEATDILVPRWWNNRFQRGSYSNYPIVSNDHFVHDI
KNPVGRIFFTGEHTSEKFSGYVHGGHLAGEQLIKGSTGDCRPPIINTTSDILSDRWIVVS
VSDYPSESLRKLVRVKGWQVLAIGNSRTPVDWSLKGVIYLSMDDQAKLEFRVLDYLPYDS
YVRKSVGYLFAIQHGAKMIYDADDRGDVADGDLGKHFDLKLSNVDVMQERILQYPNENPN
RTVVNPYIHFGQRSIWPRGLPLENVGEVAHEGYYGEVFGGMQYIQQGISNGLPDVDSVFY
FTRRSGSEEFDIRFDEHAPKVSLPQGMMVPLNSFNTLFHSNAFWALMLPVSVSTMASDVL
RGYWAQRILWEIGGHVVVYPPTIYRYDKIEAYPFTEEKDLHVNVGRLIKFLVTWRSTKIR
LFDKILELSYLMAKEGFWTEKEVKFTAAWLQDLLAVGYIQPSQKVXNLDKPRTIIGHANQ
KEFIPRKLPSVHLGVKESETVNYEIGNLIRWRKFFGNVVMILFVSGPMERTALKWRLLYG
RVFKTVVILSDSSEDKFGVEQATLDQVYKYLPKIYNRFTSAEGFLFLEDNTVLNYWNLLQ
ADKTKLWITNKVVQNPEYKTLNFKPTLTDHSCTLLQVPQSWITSSVNGKDLEWLSKQANM
VKKVVSTMPVHLQVNYKESNPREQSLVMCSSEVFYIPRQFVGDFVDLVGLVGNFEIHNKV
AVPMFFMAMDSHNNYDSVLNTMIYKPEASSSNSSSIYSAQVAAVHPWTVSSESDYIKLIR
SMATGDPLLMELF
Download sequence
Identical sequences MDP0000694227 MDP0000694227|PACid:22673619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]