SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000744735|PACid:22624347 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000744735|PACid:22624347
Domain Number 1 Region: 66-216
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 9.55e-21
Family alpha-D-mannose-specific plant lectins 0.0029
Further Details:      
 
Domain Number 2 Region: 497-579
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000000000776
Family Protein kinases, catalytic subunit 0.005
Further Details:      
 
Domain Number 3 Region: 180-275
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000112
Family alpha-D-mannose-specific plant lectins 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000744735|PACid:22624347
Sequence length 589
Sequence
MAMAFSVRMLLFSSLFLLPIYVFSQNNGRVVVGSSLTASTGNSSSWLSPSGDFAFGFSPL
GNNDLFLLSIWYAKIPDETVVWYAYDGNNPIVAPRGSVLNLTANSGLVLNNPQGGEIWKS
ETTFGIVENGVMNDTGNFVLQDQNSGSLWETFSNPTDTVLPGQTIEKNGKLSCRQSETNY
AKGRFQLRLQDDGNLVLNTVNLPTDYANNPYFATNTTAGTVEGSQGKQLVFNSSGDMFVL
RENGGRFTLTGTQGVSVRDNYIRATLDFDGIFALYSHPKNFTGNASWSNPLWYKPDDICL
TLREVLGVGVCGYNSVCKLKPDNRPTCECPKGFSFLDPQDIYRGCKPDFIQGCEEDELRS
PRKDLYDVEVLTNTDWPTSDYVQLNSFTADECNESCYQDCLCAVAVFRSETCWKKKLPLS
NGRVDVSLNSQTFIKVRKDNATLQSLPKPIPDDKEKRRKSVIRVESVLLGTSIFVNFVLS
SALCLGFFFIFRKKPVRPSTDIVLDSNLRSFSYEELREATNGFKEELGKGAFGVVFKGVM
QIGSGVEVAVKKLNCVMADVEKEFNTEVNVIGHTHHKNLQWHIGKLXFF
Download sequence
Identical sequences MDP0000744735 MDP0000744735|PACid:22624347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]