SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000746106|PACid:22660841 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000746106|PACid:22660841
Domain Number 1 Region: 385-681
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.05e-70
Family Protein kinases, catalytic subunit 0.00024
Further Details:      
 
Domain Number 2 Region: 1-107
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 9.95e-16
Family alpha-D-mannose-specific plant lectins 0.0035
Further Details:      
 
Weak hits

Sequence:  MDP0000746106|PACid:22660841
Domain Number - Region: 232-286
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000373
Family Pan module (APPLE domain) 0.04
Further Details:      
 
Domain Number - Region: 182-213
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0176
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000746106|PACid:22660841
Sequence length 708
Sequence
MVLTDXDGTAVWGTXVNSRADXAVLLDSGNLVLKDKRGKVLWQSFDIPTHTLLPNQPFTK
SKKLISTLGKGTFGTGYFSFSFDNDNVLKLMFDGPDTSSLYWPDPDYNVFAGGRTNYNSX
RVAVLDELGXFXSSDXLQFTASDAGSSAKRRLTMDYDGNLRLYSLESTTGLWVVTWEAMT
ELCKVHGICGRNGICINTPQPKCSCPPGYEVADTSDWKEGCKPMFNRXYLRSQQXKFVQI
EQVDFYGFDLNYSEPTTFENCTNLCLDDXRCEGFSYRIXEAKCFTKSALFNGYKSPNFPG
SMYIRLPXSVKTSXPVNLNASNTCRKNVTKVVPSXYGSTXRRVKWVYMYXFAFAIGALEV
LFIASAWWLLFRRHSAAAPTEDGYHIISSQFRKFRYAELKKATKNFKEELGRGASGAVYK
GVLADERVVAVKKLADIYHGEEVFWAEVSTIGKINHMNLVRIWGFCSDKKHKLLXSEHVE
NGSLDKHLFPPINFLGWQERFKVAIGIAKGLAYLHHECLEWVIHCDVKPENILLDGNFEP
KIADFGLAKLTQRGNLSSVXSQIRGTKGYMAPEWXXNLPITAKVDVYSFGVVILELVKGI
RLSSWVVEDTDDLETELTRFVRVAKRKIQCGKDLWIEDMMDPRLNXQFSRIQAAKMVEIG
ISCVEEEKSKRPTMDSVVKXLLECEGESAVASPXDTSNSNLSFRERNM
Download sequence
Identical sequences MDP0000746106 MDP0000746106|PACid:22660841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]