SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000746118|PACid:22675145 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000746118|PACid:22675145
Domain Number 1 Region: 63-166
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 9.29e-18
Family alpha-D-mannose-specific plant lectins 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000746118|PACid:22675145
Sequence length 166
Sequence
MPASLCTASITLIALIDQLHKYGAHGQTLVSSGHIFELGFFSPNSSANNYVGLXHKSIFP
RKVLWVANRDNHLAVTDTLASLTITSNGKRNSVWSTNISVSSNGSAAALLLDNGNFVVKD
NIRAAVQLWESLDYPSESLLPSMLVGFXSKSGKSQFLTAWKSENDP
Download sequence
Identical sequences MDP0000746118|PACid:22675145 MDP0000746118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]