SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000759001|PACid:22644637 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000759001|PACid:22644637
Domain Number 1 Region: 500-797
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.8e-70
Family Protein kinases, catalytic subunit 0.00019
Further Details:      
 
Domain Number 2 Region: 85-207
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 9.29e-26
Family alpha-D-mannose-specific plant lectins 0.0021
Further Details:      
 
Weak hits

Sequence:  MDP0000759001|PACid:22644637
Domain Number - Region: 347-394
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0298
Family Hairpin loop containing domain 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000759001|PACid:22644637
Sequence length 806
Sequence
MLDSFIGHMGTLFLIFLLSLAISPPPSSSASDTLRRGSSLSAEKPNDVLISPDGVFTAGF
HQVGNNSFCFAIWFTEPSSNHYQNRAVVWMANRDQPVNGKYSKLSLQSSGNLILTDAGQS
IVWATTTTSLSAAHLSLQNSGNLVLLNLDLVVLWQSFDFPTDTLLPHQPLTRNTMIVSMR
SQSNFSSGFYKLFFDNDNLLRLLFDGVEISSVYWFEPWLTGQAAGRSTDNSSRTAVLDSL
GNFTSSDSFTFMAADYGAGLQRRLTVDSDGNVRLYSREKPGDKWSVSAQVFSDPCKIHGV
CGVNSVCSYHPFHGRKCSCIPGYKMKNHTDWYYGCEPQFNYTCNKGESTFFKLSKLEFFG
YDYGYFENYTYTDCENLCLKLCNCKGFQYSRIXDRPIFSCYPKTVLLNGYRSPSFFGDLY
LRVPKTHVSYYQKPQEEYRLSCLSRVVVGLNRNYVKSSVASSVKFLLWFAIGVGGFEIIC
ILLVWGLLSNTTRRNSNEDMQGYVLAGTGFKRFSYAELKKATRGFSEEIGRGAGGIVYKG
VLADQRVAAIKLLSEADQGEVEFLGEANTIGRLNHMHLIDMWGYCSEKKHKLLVYEYMEH
GSLADKLSSNVLDWEKRFEIAVGTAKGLAYLHEECLEWVLHCDVKPQNILLDSDYQPKVA
DFGLSKLINRGGLENSSISRIRGTRGYIAPEWVYNQPITSKVDVYSYGIVVLEMXTGKNP
TIGVGGVEGEQRGLINWVREKVDGSGGIGSRMGEIIDRSVGENYDVRKMEILLEVALRCV
EEXKNARPTMTQVVEKLLRIHKXRDH
Download sequence
Identical sequences MDP0000759001 MDP0000759001|PACid:22644637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]