SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000791089|PACid:22666940 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000791089|PACid:22666940
Domain Number 1 Region: 375-664
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.36e-79
Family Protein kinases, catalytic subunit 0.0000953
Further Details:      
 
Domain Number 2 Region: 267-301
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000307
Family EGF-type module 0.0064
Further Details:      
 
Weak hits

Sequence:  MDP0000791089|PACid:22666940
Domain Number - Region: 232-274
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0205
Family EGF-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000791089|PACid:22666940
Sequence length 724
Sequence
MQLTLIELLLLAAATSSQATQFIPPPPSSPPLDQVGVKQGCRDKCGNVSIPYPFGTTPDC
YYNEEFLITCNDTHYDPPKAFLGLTDSNIVVTNISVDGKLHILQYIAKDCYNKSGASLES
NIPSLQLSELFFISDTDNMFVVVGCDTYAEIVVYQGKDYGYTGGSYPVHKAPALRRVWES
YAFIVEESKFNFSSNMLTDLKNVEVLPVVLDWLIGTETCSKVVGXKQGMNYACHGDKTCI
DVKNGRGYRCKCQDGYRGNPYLEGCHDINECEDANLNNCEQKCTNTEGGYACSCRKGYHS
KGEVDGEGCTPNPTLLIQIIVGIGVGLIALLMGSSWLYLGYKRWKLIKLKEKFFRQNGGL
MLQQQLSERQGSTHETAKIFTAEELEKDTDNYNESKIIGRGGSGTVYKGILVDGRVVAIK
KSKMVDQSQIEQFINEVLVLSQINHRNVVKLLGCCFETQVPLLVYEYVTNGTLFDYIHNT
TNESKPNTSWEIHLRIASETAEVLSYLHSAASVPIIHRDVKSTNILLDENLTAKVSDFGA
SRLVPLGQAQLFTMVQGTMGYLDPEYLQTSQLTEKSDVYSFGVVLVELLTRNKAVFFDNP
EEQINLAMYFLSALKDDRLLQVLDDWIVTEANIEQLKEVSKLAMRCLRVKGEERPTMQEV
AMELEGLRRMVLHPWVNDEFISEETQHLLGGISMETISYEGGGDSGLGYDTMRNHVALPV
NGGR
Download sequence
Identical sequences MDP0000791089 MDP0000791089|PACid:22666940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]