SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000839729|PACid:22658168 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000839729|PACid:22658168
Domain Number 1 Region: 405-693
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.78e-75
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 
Domain Number 2 Region: 52-161
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.27e-23
Family alpha-D-mannose-specific plant lectins 0.004
Further Details:      
 
Weak hits

Sequence:  MDP0000839729|PACid:22658168
Domain Number - Region: 292-330
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0412
Family Anti-platelet protein 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000839729|PACid:22658168
Sequence length 763
Sequence
MASVTISPGQSLSGSQTITSPGGKFELGFFTXGNSQNYYIGIWYKNLANRTVVWVANRQQ
PVSEPKLSVLELVENGNLTLTSPSRVAIWSTNSRSMASNSALAKLLDNGNFVITDAFNSS
VVXWQSFDYLTNTWLPGAELGYNNRTKRKQVLTPWRNSKNPALGPFSFELDEIPLPYSIS
SYPDTFTRGTIEINGQLKFYAWDQGFRGWTLLSVEPSDQCAVQGSCGAFSICHQQSSPRC
GCLKGFEPKVRENWKLEDYSDGCVRKTPFHCSPGESYSFLTLTDVEKRYNKNFKENFYVS
IDQCRLECLINCSCTGFTYNSFDSGRCYMWIGDLYDIVATSESHSISYPPFVTGLNIXXV
DSTSEMKRKTTWIVIGVIAGFFSILSAATVVVFFRRRWSAGAFVTTDDFLVLYKHRDLRR
ATNNFSEKLXEGAFGSVFKGMLPNSTAIAVKELKSMNQGEKQFRAEVGTIGAIHHINLIR
LRGFCTNASKRFLVYDYMPNGSLHSLLLGNNPIVLDWKARYHIAVGIARGLAYLHEECRD
CIIHCDVKPENILLDSEYSPKLADFGLAKLLGRHHSRVLTTMRGTVGYLAPEWFSGEAIT
PKADVFSYGMLLIEVISGRRNMEGLDNGVENFRPLWLANAVNKVEDLFAVLDCRLEGQAD
GDELSRVCKVACWCIQEDEKDRPTMRQVVQILEGVSDIGTPPVPQFXQRLIKFPAEGINY
QETTSGSGAWLCSDVQSAFQAEVSNCATKSHEDQMKGVRVLVL
Download sequence
Identical sequences MDP0000839729|PACid:22658168 MDP0000839729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]