SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000884600|PACid:22641871 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000884600|PACid:22641871
Domain Number 1 Region: 71-219
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.03e-20
Family alpha-D-mannose-specific plant lectins 0.0042
Further Details:      
 
Domain Number 2 Region: 182-278
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000461
Family alpha-D-mannose-specific plant lectins 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000884600|PACid:22641871
Sequence length 398
Sequence
MGAFAMAVALSVEMLLFSSLFLLPISVISQNNGRVAVGSSLTATTGDSSSWLSPSGDFAF
GFSPLGNNDRFLLSIWYAKIPDKTVVWYAYDGNNPMVAPGGSVLNLTANSGLVLNNPQGG
EIWKSEITLGTVANGVMNDTGNFVLQHQNSGSLWETFSNPTDTVLPGQTIERNGTLSCRQ
SETNYTKGRFQLSLQGDGNLVLISVTTDNANIPYFSTKTTSGNVPGSQGKRLVFSSSGDM
FVLRENDGRVPLKGTEGVSVRDNYIRATLDFDGIFALYSHQKNFTGNASWISPLVYMPDD
ICLRLGVGVCGYNSTCMLKPDKRPTCECPKGFSFLDPKDIYRGCKPDLSRKSVTRVESVL
LDKWVWIGISIAAALVLCTAYYLLRRRRSALASAGIFL
Download sequence
Identical sequences MDP0000884600 MDP0000884600|PACid:22641871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]