SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000903805|PACid:22678063 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000903805|PACid:22678063
Domain Number 1 Region: 43-332,503-557
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.22e-43
Family FAD-linked reductases, N-terminal domain 0.000000409
Further Details:      
 
Domain Number 2 Region: 336-504
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 6.77e-31
Family GMC oxidoreductases 0.00000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000903805|PACid:22678063
Sequence length 560
Sequence
MEKSTTAAILLLLYIFGLCPQPGVPSFANPSDDLGKYSLKVPLVFQNFSYLKFVRNATDL
PLQEEYDYIVVGGGTAGCPLATTLSANYSVLLLERGNIPSAYPNVLLANGTFANFMQEDD
GKTPAQRFTSEDGVANLRGRVLGRGSMINVALYSRADGEFYEKSGIKLDMNLVNNSYEWV
ENTVAFRPNLSHWQSVVKDAMVEAGVRPDNGLTVDHILGSKVTATLFDDRGKRHGAVEHL
NKGHPKNLRVAILATVERIIFSSKASGLSAKGIIYSDSNGRSHRALIRGKGEVILSAGAL
GSPQLLLLSGVXPKSYLSSLKIPVVHPQPYIGQXMRDNPRNYVTILPPFQIELSTTQVVG
ISSDYYIETNSGLPYSTQIFSLFPSPTIPNTINSSFGQISVKSPGPFSYGSLKLQSSYDV
KVAPNVKFNYFAQEADLSRCVSAVRKMGDLLKTNSLKPYKARDLPGLDGFNLFGPPLPMN
QSDDASLKTFCRDTVATFWHYHGGCVVGKVVDEDLRVMGIKALRVVDGSVFNLSPGTNPQ
ATLMMLGRYVGVQMLEERSE
Download sequence
Identical sequences MDP0000903805 MDP0000903805|PACid:22678063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]