SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000933541|PACid:22644761 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000933541|PACid:22644761
Domain Number 1 Region: 472-742
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.4e-72
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 2 Region: 73-196
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.96e-18
Family alpha-D-mannose-specific plant lectins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000933541|PACid:22644761
Sequence length 788
Sequence
MGSCRTCLLIFSSLVVWTYYYTAASAQVTHKPGDTLKPGESLNSTTWLCSAMGTFCLGFC
VYDKSNSSQLCIWARDTSNTGWIASRDKPVLYPTGVLTLDKNKTLKIMDQGRTRLELYSA
SRETANTNTSTVVATLLDSGNFILQEVNTIHGSKNRILWQSFDHPTDTLYPGMMLGVNHR
NGHMLSLTSWSSDYNPKPEPFTLEWDYKTQELQIKRRGVVYWTSGALTNKRFKLLRRRYN
FSIVSNKNEDYFFYYSLSQTSASEWYLTSSGLLFDYGGVDIARADNCYGYNTDGGCQRWA
EKPTCRHVGDIFELKTGFFKPTTTNSTPDSTFPSDSNESLSISDCKDSCWKNCECLGYTF
LNADDESGCQYYTGINWEFIQDFTGDSTQNFNMLKTKSPHSNGTKKRIFIGTGITVATLL
LMVPCIACYVVRRRKFALSGEKETNIIEDELLDLMRSDRPTDANARQNDGNMRHDLSVFS
YASVMAATCNFSQENKLGQGGFGPVYKGKLVTGQEVAVKRLSKCSGQGTLEFKNELILIY
ELQHKNLVKLFGFCIHDSTRVTLLDWKKRFSIIEGIAQGLLYLHKYSRVTVIHRDLKASN
ILLDENMNPKISDFGMARIFKHNELEANTNRVVGTYGYMSPEYAMEGLFSIKSDVYSFGV
LMLEIVSGRRNNSFYNADRLLNIVGYAWELWKEGTVLELMDPALGDSCIKDQLLRCVHVG
LLCVEENAADRPTMSDVVSMLTNQSSPLPLPAKAAFFTGRNVVENGSGGKKSEFFSSNEI
SDYTAVPR
Download sequence
Identical sequences MDP0000933541|PACid:22644761 MDP0000933541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]