SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000936164|PACid:22630137 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000936164|PACid:22630137
Domain Number 1 Region: 486-774
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.32e-78
Family Protein kinases, catalytic subunit 0.0001
Further Details:      
 
Domain Number 2 Region: 78-198
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000000000864
Family alpha-D-mannose-specific plant lectins 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000936164|PACid:22630137
Sequence length 822
Sequence
MEIINLILLIIFECLVWTCHRAASARDTLKPGDTLNSSSSLISASGNFSFSFYVYNDGSK
NTSYISIQRNKANGNIAWIGNPEAPILYPPSAFLTLDRNNTLKIMRQGGDSNPIVIFSAR
QTTRSTNISNSNDTVVAILLDSGNFVLQEVNSVDGSPEQVLWQSFDYPVDTLLSGMKLGV
NRTNGHVWSISSWETEENPVPGPFTLDWDPTDHQLKIKKGEVVYWTSGAFTSSTNTFEYI
LPEESKLWFNFSIVSNENEDYLTYTALDLDQDSEWVLNNLGRLGNLNFEIAQAGNCDGYN
TGGGCMRRDRPPNCMAKFGDEFEVKNGFFIPSNISSRSPYWFTSSSSDCKATCWQNCDCV
GFDFPLDDNTNTSTGCRFWSADSKFVEDFAGSGTANSSFALPRLITPSKSPLRKDNTANK
WIWIGTSIAIALVLCIVFYLLRRRRLALSAGENITKIQNELLNFMRPNRVTHLAHGIQND
GKMEHHDLSAFSYTSVLAATCNFSEENKLGQGGYGPVYKGKLVTGQEIAVKRLSKCSGQG
TSEFKNELILIYELQHTNLVRLFGFCIHEEERMLIYEYMPNKSLDYFLFDSTRGLLLDWK
KRYGIIEGITQGLLYLHKYSRTKVIHRDLKASNILLDENMNPKISDFGMARIFTENELEG
NTSRVVGTRGYMPPESIEGIVSVKSDVYGFGVLMLEIISGRKNSSFYNDDHAINLVGHAW
ESWKDGAALELIDPILIGDSCIADQVLRCIHVGLLCVEEDAADRPTMSDVISMLTNESSP
LAFPTKPAFFVGRKMAGAGTSGNQQLEIASVNDMSNSDFGAR
Download sequence
Identical sequences MDP0000936164 MDP0000936164|PACid:22630137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]