SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000945035|PACid:22653164 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000945035|PACid:22653164
Domain Number 1 Region: 488-781
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.34e-71
Family Protein kinases, catalytic subunit 0.00029
Further Details:      
 
Domain Number 2 Region: 63-192
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 5.76e-26
Family alpha-D-mannose-specific plant lectins 0.0032
Further Details:      
 
Weak hits

Sequence:  MDP0000945035|PACid:22653164
Domain Number - Region: 168-277
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0345
Family alpha-D-mannose-specific plant lectins 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000945035|PACid:22653164
Sequence length 800
Sequence
MAWPLINRLFFLLMFLPFSTLAQTSKNISLGSSLTALKDGNPSWPSPSGEFAFGFREVAK
DGFLLAIWFDEIPNKTIVWSANRDNLVPKGSKVELTVDGEFILNDATGKRIWYTQSAGSG
VAYASMLDTGNFVLANRSSSYVWESFSHPTDTILPSQTLNQNGILYARYTATNYSTGRFL
FSLQPDGNLVLATTKFPQNAPNEAYWLVRNPNTGFRFIFNESGFMYVTSKNGSLLSTIPS
TMVSTQDFYQRATLEYNGVFRHYVYPKSNSSSSGRWNMAWSTSSYEPPNICMSILESSGG
GACGFNGLCKLEDQGPTCQCPNGYSFIDPNDELRGCKPDFVPQSCGEDSKEETDPFDIQE
LQNADYYGGDYADFREVSEDWCRQNCLDDCFCGVALFRTGQCVKKRLPFPNGRIHPNLTG
KLLIKVGKRNPNVKSGGCANTEKKDHKTLILFGSVILSGSGVLNFLLPLITYLVVSRSYS
RKAKVSQTHPVISGMNLKHFTYEELNNATNQFKEELGRGASAIVFKGVLASDNGKSVAVK
SLDTRVGENDLEFKAEVSAIGRTNHRNLVQLLGFCYEGEHRILVYEFMSNGSLAGVLFGE
SMPNWYQRRQIALEIARGLLYLHEESSSQIIHCDIKPQNILLDXXLTAXISDFGLAKLLR
IDQTLTMTXIRGTKGYVAPEWFKRLPITAKVDIYSYGILLLEXIFCRKHFEAAAEDEGPT
ILADWAYDCYKQNXLHQLFKNNDEAMHDMKMVEKYVLIAIWCIQEDPSLRPNMKKVTLML
EGTVEVSAPPDPSSFISSIL
Download sequence
Identical sequences MDP0000945035|PACid:22653164 MDP0000945035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]